SCOPe 2.05: Domain d4wf2a2: 4wf2 A:64-270

Lineage for d4wf2a2 (4wf2 A:64-270)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)

6. Protein automated matches [260609] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [260610] (1 PDB entry)

8. Domain d4wf2a2: 4wf2 A:64-270 [260611]
   Other proteins in same PDB: d4wf2a1, d4wf2a3
   automated match to d1biaa3
   complexed with btx

Details for d4wf2a2

PDB Entry: 4wf2, 2.31 Å

PDB Description: structure of e. coli bira g142a bound to biotinol-5'-amp

PDB Compounds: (A:) Bifunctional ligase/repressor BirA

SCOPe Domain Sequences for d4wf2a2:

Sequence, based on SEQRES records:

>d4wf2a2 d.104.1.2 (A:64-270) automated matches {Escherichia coli [TaxId: 83333]}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqapaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli
relraalelfeqeglapylsrwekldn

Sequence, based on observed residues (ATOM records):

>d4wf2a2 d.104.1.2 (A:64-270) automated matches {Escherichia coli [TaxId: 83333]}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqapaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltdaaqivigaginmamgwitlqeaginldrntlaamlirelraalelfeqeg
lapylsrwekldn

Timeline for d4wf2a2:

• d4wf2a2 first appeared in SCOPe 2.04
  
• d4wf2a2 appears in SCOPe 2.06
  
• d4wf2a2 appears in the current release, SCOPe 2.08