Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins) |
Protein automated matches [260609] (1 species) not a true protein |
Species Escherichia coli [TaxId:83333] [260610] (1 PDB entry) |
Domain d4wf2a2: 4wf2 A:64-270 [260611] Other proteins in same PDB: d4wf2a1, d4wf2a3 automated match to d1biaa3 complexed with btx |
PDB Entry: 4wf2 (more details), 2.31 Å
SCOPe Domain Sequences for d4wf2a2:
Sequence, based on SEQRES records: (download)
>d4wf2a2 d.104.1.2 (A:64-270) automated matches {Escherichia coli [TaxId: 83333]} iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw fspfganlylsmfwrleqapaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli relraalelfeqeglapylsrwekldn
>d4wf2a2 d.104.1.2 (A:64-270) automated matches {Escherichia coli [TaxId: 83333]} iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw fspfganlylsmfwrleqapaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk lagilveltdaaqivigaginmamgwitlqeaginldrntlaamlirelraalelfeqeg lapylsrwekldn
Timeline for d4wf2a2: