Lineage for d4wf2a1 (4wf2 A:3-63)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480052Species Escherichia coli [TaxId:83333] [260606] (3 PDB entries)
  8. 1480053Domain d4wf2a1: 4wf2 A:3-63 [260607]
    Other proteins in same PDB: d4wf2a2, d4wf2a3
    automated match to d1biaa1
    complexed with btx

Details for d4wf2a1

PDB Entry: 4wf2 (more details), 2.31 Å

PDB Description: structure of e. coli bira g142a bound to biotinol-5'-amp
PDB Compounds: (A:) Bifunctional ligase/repressor BirA

SCOPe Domain Sequences for d4wf2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wf2a1 a.4.5.0 (A:3-63) automated matches {Escherichia coli [TaxId: 83333]}
dntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslpe
p

SCOPe Domain Coordinates for d4wf2a1:

Click to download the PDB-style file with coordinates for d4wf2a1.
(The format of our PDB-style files is described here.)

Timeline for d4wf2a1: