Class a: All alpha proteins [46456] (285 folds) |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (23 PDB entries) |
Domain d4urka3: 4urk A:544-725 [260599] Other proteins in same PDB: d4urka1, d4urka2, d4urka4 automated match to d1e7ua1 complexed with a82 |
PDB Entry: 4urk (more details), 2.9 Å
SCOPe Domain Sequences for d4urka3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4urka3 a.118.1.0 (A:544-725) automated matches {Human (Homo sapiens) [TaxId: 9606]} raempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqei vaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllql vqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrg cg
Timeline for d4urka3: