Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
Domain d4rdqh2: 4rdq H:108-212 [260585] Other proteins in same PDB: d4rdqf1, d4rdqh1, d4rdqj1, d4rdql1, d4rdqn1 automated match to d2fd6l2 complexed with c6n, ca, cl, gol, k |
PDB Entry: 4rdq (more details), 2.85 Å
SCOPe Domain Sequences for d4rdqh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rdqh2 b.1.1.2 (H:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d4rdqh2: