Lineage for d4pj0l_ (4pj0 L:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. Species Thermosynechococcus elongatus [TaxId:146786] [161020] (2 PDB entries)
    Uniprot Q8DIN8 1-37
  8. 1698644Domain d4pj0l_: 4pj0 L: [260552]
    Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0z_
    automated match to d2axtl1
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0l_

PDB Entry: 4pj0 (more details), 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d4pj0l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj0l_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
epnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d4pj0l_:

Click to download the PDB-style file with coordinates for d4pj0l_.
(The format of our PDB-style files is described here.)

Timeline for d4pj0l_: