Lineage for d4pj0m_ (4pj0 M:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. Species Thermosynechococcus elongatus [TaxId:146786] [161036] (4 PDB entries)
    Uniprot Q8DHA7 1-36
  8. 1698705Domain d4pj0m_: 4pj0 M: [260551]
    Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0z_
    automated match to d2axtm1
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0m_

PDB Entry: 4pj0 (more details), 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d4pj0m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj0m_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
mevnqlgliatalfvlvpsvfliilyvqtesq

SCOPe Domain Coordinates for d4pj0m_:

Click to download the PDB-style file with coordinates for d4pj0m_.
(The format of our PDB-style files is described here.)

Timeline for d4pj0m_: