| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) ![]() automatically mapped to Pfam PF02532 |
| Family f.23.37.1: PsbI-like [161042] (1 protein) Pfam PF02532 |
| Protein Photosystem II reaction center protein I, PsbI [161043] (3 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161044] (7 PDB entries) Uniprot Q8DJZ6 1-35 |
| Domain d4pj0i_: 4pj0 I: [260550] Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_ automated match to d2axti1 complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl |
PDB Entry: 4pj0 (more details), 2.44 Å
SCOPe Domain Sequences for d4pj0i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj0i_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 146786]}
metlkitvyivvtffvllfvfgflsgdparnpk
Timeline for d4pj0i_: