Lineage for d4pj0i_ (4pj0 I:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254921Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 2254922Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 2254923Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 2254924Species Thermosynechococcus elongatus [TaxId:146786] [161044] (4 PDB entries)
    Uniprot Q8DJZ6 1-35
  8. 2254925Domain d4pj0i_: 4pj0 I: [260550]
    Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_
    automated match to d2axti1
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0i_

PDB Entry: 4pj0 (more details), 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d4pj0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj0i_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 146786]}
metlkitvyivvtffvllfvfgflsgdparnpk

SCOPe Domain Coordinates for d4pj0i_:

Click to download the PDB-style file with coordinates for d4pj0i_.
(The format of our PDB-style files is described here.)

Timeline for d4pj0i_: