Lineage for d4pj0f_ (4pj0 F:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632073Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2632074Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2632107Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species)
  7. 2632108Species Thermosynechococcus elongatus [TaxId:146786] [161050] (5 PDB entries)
    Uniprot Q8DIN9 11-45
  8. 2632110Domain d4pj0f_: 4pj0 F: [260546]
    Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_
    automated match to d2axtf1
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0f_

PDB Entry: 4pj0 (more details), 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d4pj0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj0f_ f.23.38.1 (F:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus elongatus [TaxId: 146786]}
ypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d4pj0f_:

Click to download the PDB-style file with coordinates for d4pj0f_.
(The format of our PDB-style files is described here.)

Timeline for d4pj0f_: