SCOPe 2.07: Domain d4pj0f_: 4pj0 F:

Lineage for d4pj0f_ (4pj0 F:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161050] (5 PDB entries)
   Uniprot Q8DIN9 11-45

8. Domain d4pj0f_: 4pj0 F: [260546]
   Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_
   automated match to d2axtf1
   complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0f_

PDB Entry: 4pj0, 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing

PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d4pj0f_:

Sequence; same for both SEQRES and ATOM records:

>d4pj0f_ f.23.38.1 (F:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus elongatus [TaxId: 146786]}
ypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d4pj0f_:

• d4pj0f_ first appeared in SCOPe 2.04
  
• d4pj0f_ appears in SCOPe 2.06
  
• d4pj0f_ appears in the current release, SCOPe 2.08