Lineage for d4pj0h_ (4pj0 H:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family) (S)
    automatically mapped to Pfam PF00737
  5. Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. Protein Photosystem II reaction center protein H, PsbH [161027] (1 species)
  7. Species Thermosynechococcus elongatus [TaxId:146786] [161028] (2 PDB entries)
    Uniprot Q8DJ43 2-65
  8. 1698677Domain d4pj0h_: 4pj0 H: [260545]
    Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0z_
    automated match to d2axth1
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0h_

PDB Entry: 4pj0 (more details), 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d4pj0h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj0h_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka

SCOPe Domain Coordinates for d4pj0h_:

Click to download the PDB-style file with coordinates for d4pj0h_.
(The format of our PDB-style files is described here.)

Timeline for d4pj0h_: