Lineage for d4pj0c_ (4pj0 C:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. Protein automated matches [191285] (2 species)
    not a true protein
  7. 1699948Species Thermosynechococcus elongatus [TaxId:197221] [260540] (1 PDB entry)
  8. 1699949Domain d4pj0c_: 4pj0 C: [260544]
    Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0z_
    automated match to d3arcc_
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0c_

PDB Entry: 4pj0 (more details), 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing
PDB Compounds: (C:) Photosystem II CP43 protein

SCOPe Domain Sequences for d4pj0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj0c_ f.55.1.1 (C:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
rdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqg
liliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyss
ffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptld
prvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafi
wsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklg
anvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiq
pwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwha
graraaaagfekgidresepvlsmpsld

SCOPe Domain Coordinates for d4pj0c_:

Click to download the PDB-style file with coordinates for d4pj0c_.
(The format of our PDB-style files is described here.)

Timeline for d4pj0c_: