| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein Photosystem II reaction center d2 protein PsbD2 [161051] (2 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161052] (5 PDB entries) Uniprot Q8CM25 13-352 |
| Domain d4pj0d_: 4pj0 D: [260542] Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_ automated match to d2axtd1 complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl |
PDB Entry: 4pj0 (more details), 2.44 Å
SCOPe Domain Sequences for d4pj0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj0d_ f.26.1.1 (D:) Photosystem II reaction center d2 protein PsbD2 {Thermosynechococcus elongatus [TaxId: 146786]}
gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn
fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei
arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt
lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf
wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe
tfytknlllnegirawmapqdqphenfvfpeevlprgnal
Timeline for d4pj0d_: