Lineage for d1ca0.2 (1ca0 F:,G:,H:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60421Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)
  7. 60422Species Cow (Bos taurus) [TaxId:9913] [50523] (42 PDB entries)
  8. 60459Domain d1ca0.2: 1ca0 F:,G:,H: [26054]
    Other proteins in same PDB: d1ca0d_, d1ca0i_

Details for d1ca0.2

PDB Entry: 1ca0 (more details), 2.1 Å

PDB Description: bovine chymotrypsin complexed to appi

SCOP Domain Sequences for d1ca0.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ca0.2 b.47.1.2 (F:,G:,H:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicag
asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
n

SCOP Domain Coordinates for d1ca0.2:

Click to download the PDB-style file with coordinates for d1ca0.2.
(The format of our PDB-style files is described here.)

Timeline for d1ca0.2: