SCOPe 2.04: Domain d4olvl2: 4olv L:108-216

Lineage for d4olvl2 (4olv L:108-216)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4olvl2: 4olv L:108-216 [260531]
   automated match to d4lssl2
   complexed with nag

Details for d4olvl2

PDB Entry: 4olv, 2.5 Å

PDB Description: crystal structure of antibody vrc07-g54f in complex with clade a/e 93th057 hiv-1 gp120 core

PDB Compounds: (L:) Antigen binding fragment of light chain: Antibody VRC01

SCOPe Domain Sequences for d4olvl2:

Sequence; same for both SEQRES and ATOM records:

>d4olvl2 b.1.1.0 (L:108-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvte
qdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d4olvl2:

• d4olvl2 is new in SCOPe 2.04-stable
  
• d4olvl2 appears in SCOPe 2.05
  
• d4olvl2 appears in the current release, SCOPe 2.08