SCOPe 2.06: Domain d1dlk.2: 1dlk C:,D:

Lineage for d1dlk.2 (1dlk C:,D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (60 PDB entries)
   Uniprot P00766

8. Domain d1dlk.2: 1dlk C:,D: [26052]
   delta-chymotrypsin
   complexed with cl

Details for d1dlk.2

PDB Entry: 1dlk, 2.14 Å

PDB Description: crystal structure analysis of delta-chymotrypsin bound to a peptidyl chloromethyl ketone inhibitor

PDB Compounds: (C:) Thrombin light chain, (D:) Thrombin heavy chain

SCOPe Domain Sequences for d1dlk.2:

Sequence; same for both SEQRES and ATOM records:

>g1dlk.2 b.47.1.2 (C:,D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvt
tsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsav
clpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdami
cagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqt
laan

Timeline for d1dlk.2:

• d1dlk.2 first appeared (with stable ids) in SCOP 1.55
  
• d1dlk.2 appears in SCOPe 2.05
  
• d1dlk.2 appears in SCOPe 2.07
  
• d1dlk.2 appears in the current release, SCOPe 2.08