SCOPe 2.06: Domain d4maoa_: 4mao A:

Lineage for d4maoa_ (4mao A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (25 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [194605] (24 PDB entries)

8. Domain d4maoa_: 4mao A: [260508]
   automated match to d2bdwa_
   complexed with 28d, na

Details for d4maoa_

PDB Entry: 4mao, 2.6 Å

PDB Description: RSK2 T493M C-Terminal Kinase Domain in Complex with RMM58

PDB Compounds: (A:) Ribosomal protein S6 kinase alpha-3

SCOPe Domain Sequences for d4maoa_:

Sequence; same for both SEQRES and ATOM records:

>d4maoa_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
siqftdgyevkedigvgsysvckrcihkatnmefavkiidkskrdpteeieillrygqhp
niitlkdvyddgkyvyvvmelmkggelldkilrqkffsereasavlftitktveylhaqg
vvhrdlkpsnilyvdesgnpesiricdfgfakqlraengllmtpcytanfvapevlerqg
ydaacdiwslgvllytmltgytpfangpddtpeeilarigsgkfslsggywnsvsdtakd
lvskmlhvdphqrltaalvlrhpwivhwdqlpqyqlnrqdaphlvkgamaatysalnr

Timeline for d4maoa_:

• d4maoa_ first appeared in SCOPe 2.04
  
• d4maoa_ appears in SCOPe 2.05
  
• d4maoa_ appears in SCOPe 2.07
  
• d4maoa_ appears in the current release, SCOPe 2.08