SCOPe 2.08: Domain d3wxcb_: 3wxc B:

Lineage for d3wxcb_ (3wxc B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (14 species)

7. Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (7 PDB entries)

8. Domain d3wxcb_: 3wxc B: [260475]
   automated match to d1jjea_
   complexed with c93, zn

Details for d3wxcb_

PDB Entry: 3wxc, 2.1 Å

PDB Description: Crystal Structure of IMP-1 metallo-beta-lactamase complexed with a 3-aminophtalic acid inhibitor

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3wxcb_:

Sequence; same for both SEQRES and ATOM records:

>d3wxcb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglne

Timeline for d3wxcb_:

• d3wxcb_ first appeared in SCOPe 2.04
  
• d3wxcb_ appears in SCOPe 2.07