Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein Zn metallo-beta-lactamase [56283] (14 species) |
Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (7 PDB entries) |
Domain d3wxcb_: 3wxc B: [260475] automated match to d1jjea_ complexed with c93, zn |
PDB Entry: 3wxc (more details), 2.1 Å
SCOPe Domain Sequences for d3wxcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wxcb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll kskygkaklvvpshsevgdasllkltleqavkglne
Timeline for d3wxcb_: