SCOPe 2.04: Domain d3wxca_: 3wxc A:

Lineage for d3wxca_ (3wxc A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (12 species)

7. Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (5 PDB entries)

8. Domain d3wxca_: 3wxc A: [260474]
   automated match to d1jjea_
   complexed with c93, zn

Details for d3wxca_

PDB Entry: 3wxc, 2.1 Å

PDB Description: Crystal Structure of IMP-1 metallo-beta-lactamase complexed with a 3-aminophtalic acid inhibitor

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3wxca_:

Sequence; same for both SEQRES and ATOM records:

>d3wxca_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglnes

Timeline for d3wxca_:

• d3wxca_ is new in SCOPe 2.04-stable
  
• d3wxca_ appears in SCOPe 2.05
  
• d3wxca_ appears in the current release, SCOPe 2.08