SCOPe 2.04: Domain d2rukb_: 2ruk B:

Lineage for d2rukb_ (2ruk B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.9: TFIIH domain [110272] (2 proteins)

6. Protein TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain [110273] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110274] (3 PDB entries)
   Uniprot P32780 1-108

8. Domain d2rukb_: 2ruk B: [260438]
   automated match to d1pfja_

Details for d2rukb_

PDB Entry: 2ruk

PDB Description: solution structure of the complex between p53 transactivation domain 2 and tfiih p62 ph domain

PDB Compounds: (B:) General transcription factor IIH subunit 1

SCOPe Domain Sequences for d2rukb_:

Sequence; same for both SEQRES and ATOM records:

>d2rukb_ b.55.1.9 (B:) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan

Timeline for d2rukb_:

• d2rukb_ is new in SCOPe 2.04-stable
  
• d2rukb_ appears in SCOPe 2.05
  
• d2rukb_ appears in the current release, SCOPe 2.08