SCOPe 2.05: Domain d4r18w_: 4r18 W:

Lineage for d4r18w_ (4r18 W:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (70 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4r18w_: 4r18 W: [260416]
   Other proteins in same PDB: d4r18c_, d4r18d_, d4r18e_, d4r18f_, d4r18g_, d4r18h_, d4r18m_, d4r18p_, d4r18q_, d4r18r_, d4r18s_, d4r18t_, d4r18u_, d4r18v_
   automated match to d1g0ui_
   complexed with aba, mg

Details for d4r18w_

PDB Entry: 4r18, 2.4 Å

PDB Description: Ligand-induced Lys33-Thr1 crosslinking at subunit beta5 of the yeast 20S proteasome

PDB Compounds: (W:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d4r18w_:

Sequence; same for both SEQRES and ATOM records:

>d4r18w_ d.153.1.4 (W:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

Timeline for d4r18w_:

• d4r18w_ first appeared in SCOPe 2.04
  
• d4r18w_ appears in SCOPe 2.06
  
• d4r18w_ appears in the current release, SCOPe 2.08