Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries) |
Domain d4r18q_: 4r18 Q: [260413] Other proteins in same PDB: d4r18a_, d4r18b_, d4r18e_, d4r18g_, d4r18i_, d4r18j_, d4r18k_, d4r18l_, d4r18n_, d4r18o_, d4r18s_, d4r18u_, d4r18w_, d4r18x_, d4r18y_, d4r18z_ automated match to d1rypd_ complexed with aba, mg |
PDB Entry: 4r18 (more details), 2.4 Å
SCOPe Domain Sequences for d4r18q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r18q_ d.153.1.4 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4r18q_: