Lineage for d2vgc.1 (2vgc A:,B:,C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1318446Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 1318447Species Cow (Bos taurus) [TaxId:9913] [50523] (58 PDB entries)
    Uniprot P00766
  8. 1318477Domain d2vgc.1: 2vgc A:,B:,C: [26036]
    complexed with so4, v35

Details for d2vgc.1

PDB Entry: 2vgc (more details), 1.8 Å

PDB Description: gamma-chymotrypsin d-para-chloro-1-acetamido boronic acid inhibitor complex
PDB Compounds: (A:) gamma chymotrypsin, (B:) gamma chymotrypsin, (C:) gamma chymotrypsin

SCOPe Domain Sequences for d2vgc.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g2vgc.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryXtpdrlqqaslpllsntnckkywgtkikdamicagasg
vsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOPe Domain Coordinates for d2vgc.1:

Click to download the PDB-style file with coordinates for d2vgc.1.
(The format of our PDB-style files is described here.)

Timeline for d2vgc.1: