SCOPe 2.04: Domain d4p7mb_: 4p7m B:

Lineage for d4p7mb_ (4p7m B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.0: automated matches [191533] (1 protein)
   not a true family

6. Protein automated matches [190903] (18 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:5833] [260351] (2 PDB entries)

8. Domain d4p7mb_: 4p7m B: [260353]
   automated match to d2wkbe_
   complexed with 2oe

Details for d4p7mb_

PDB Entry: 4p7m, 3.02 Å

PDB Description: crystal structure of plasmodium falciparum mif in complex with 3-[(2- methyl-6-phenylpyridin-4-yl)oxy]phenol

PDB Compounds: (B:) Macrophage migration inhibitory factor-like protein

SCOPe Domain Sequences for d4p7mb_:

Sequence, based on SEQRES records:

>d4p7mb_ d.80.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 5833]}
pccevitnvnlpddnvqstlsqienaisdvmgkplgyimsnydyqknlrfggsneaycfv
ritsigginrsnnsaladqitkllvsnlnvksrriyvefrdcsaqnfafsgs

Sequence, based on observed residues (ATOM records):

>d4p7mb_ d.80.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 5833]}
pccevitnvnlpddnvqstlsqienaisdvkplgyimsnydyqknlrfggsneaycfvri
tsinnsaladqitkllvsnlnvksrriyvefrdcnfafgs

Timeline for d4p7mb_:

• d4p7mb_ is new in SCOPe 2.04-stable
  
• d4p7mb_ appears in SCOPe 2.05
  
• d4p7mb_ appears in the current release, SCOPe 2.08