Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
Superfamily f.6.1: Leukocidin-like [56959] (3 families) |
Family f.6.1.0: automated matches [227293] (1 protein) not a true family |
Protein automated matches [227114] (4 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [259901] (2 PDB entries) |
Domain d4p1yd_: 4p1y D: [260349] Other proteins in same PDB: d4p1yc_ automated match to d4iyaa_ |
PDB Entry: 4p1y (more details), 2.99 Å
SCOPe Domain Sequences for d4p1yd_:
Sequence, based on SEQRES records: (download)
>d4p1yd_ f.6.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 158878]} digqgaeiikrtqditskrlaitqniqfdfvkdkkynkdalvvkmqgfissrttysdlkk ypyikrmiwpfqynislktkdsnvdlinylpknkidsadvsqklgyniggnfqsapsigg sgsfnysktisynqknyvtevesqnskgvkwgvkansfvtpngqvsaydqylfaqdptgp aardyfvpdnqlppliqsgfnpsfittlshergkgdksefeitygrnmdatyayvtrhrl avdrkhdafknrnvtvkyevnwkthevkiksitpk
>d4p1yd_ f.6.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 158878]} digqgaeiikrtqditskrlaitqniqfdfvkdkkynkdalvvkmqgfissrttysdlkk ypyikrmiwpfqynislktkdsnvdlinylpknkidsadvsqklgynigsgsfnysktis ynqknyvtevesqnskgvkwgvkansfvtpngqvsaydqylfaqdptgpaardyfvpdnq lppliqsgfnpsfittlshergkgdksefeitygrnmdatyayvtrhrlavdrkhdafkn rnvtvkyevnwkthevkiksitpk
Timeline for d4p1yd_: