Lineage for d4nw7a_ (4nw7 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1508295Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1508296Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1508381Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1508633Protein automated matches [190370] (1 species)
    not a true protein
  7. 1508634Species Human (Homo sapiens) [TaxId:9606] [187208] (23 PDB entries)
  8. 1508648Domain d4nw7a_: 4nw7 A: [260343]
    automated match to d3hmva_
    complexed with 2o5, edo, mg, na, zn

Details for d4nw7a_

PDB Entry: 4nw7 (more details), 2.15 Å

PDB Description: PDE4 catalytic domain
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d4nw7a_:

Sequence, based on SEQRES records: (download)

>d4nw7a_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktf
rissdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaif
aaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkk
qrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvh
cadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidy
ivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfqf

Sequence, based on observed residues (ATOM records): (download)

>d4nw7a_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktf
rissdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaif
aaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkk
qrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvh
cadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidy
ivhplwetwadlvqpdaqdildtlednrnwyqsmipqlmekfqf

SCOPe Domain Coordinates for d4nw7a_:

Click to download the PDB-style file with coordinates for d4nw7a_.
(The format of our PDB-style files is described here.)

Timeline for d4nw7a_:

  • d4nw7a_ appears in periodic updates to SCOPe 2.04 starting on 2014-10-16
  • d4nw7a_ appears in SCOPe 2.05
  • d4nw7a_ appears in the current release, SCOPe 2.07, called d4nw7a1