SCOPe 2.06: Domain d4npna_: 4npn A:

Lineage for d4npna_ (4npn A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)

8. Domain d4npna_: 4npn A: [260331]
   automated match to d2ekec_

Details for d4npna_

PDB Entry: 4npn, 1.63 Å

PDB Description: Crystal structure of human tetra-SUMO-2

PDB Compounds: (A:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d4npna_:

Sequence; same for both SEQRES and ATOM records:

>d4npna_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaql
emededtidvf

Timeline for d4npna_:

• d4npna_ first appeared in SCOPe 2.04
  
• d4npna_ appears in SCOPe 2.05
  
• d4npna_ appears in SCOPe 2.07
  
• d4npna_ appears in the current release, SCOPe 2.08