SCOPe 2.06: Domain d4m8va1: 4m8v A:1-99

Lineage for d4m8va1 (4m8v A:1-99)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88602] (424 PDB entries)
   Uniprot P61769 21-119 ! Uniprot P01884

8. Domain d4m8va1: 4m8v A:1-99 [260320]
   Other proteins in same PDB: d4m8va2
   automated match to d1k5nb_
   mutant

Details for d4m8va1

PDB Entry: 4m8v, 1.95 Å

PDB Description: crystal structure of human double mutant beta2-microglobulin q8h-l65t

PDB Compounds: (A:) Beta-2-microglobulin

SCOPe Domain Sequences for d4m8va1:

Sequence; same for both SEQRES and ATOM records:

>d4m8va1 b.1.1.2 (A:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
iqrtpkihvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw
sfyltyyteftptekdeyacrvnhvtlsqpkivkwdrdm

Timeline for d4m8va1:

• d4m8va1 first appeared in SCOPe 2.04, called d4m8va_
  
• d4m8va1 was called d4m8va_ in SCOPe 2.05
  
• d4m8va1 appears in SCOPe 2.07
  
• d4m8va1 appears in the current release, SCOPe 2.08