Lineage for d4ktxa_ (4ktx A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1660932Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 1660933Protein Botulinum neurotoxin [55513] (4 species)
  7. 1660934Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (25 PDB entries)
    Uniprot P10845 1-419
  8. 1660966Domain d4ktxa_: 4ktx A: [260313]
    automated match to d4ej5a_
    complexed with gol, pgo, so4, zn; mutant

Details for d4ktxa_

PDB Entry: 4ktx (more details), 2.59 Å

PDB Description: crystal structure of the catalytic domain of botulinum neurotoxin bont/a c134s mutant with covalent inhibitor that modifies cys-165 causing disorder in 167-174 stretch
PDB Compounds: (A:) Botulinum neurotoxin A light chain

SCOPe Domain Sequences for d4ktxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ktxa_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
gshmpfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeeg
dlnpppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipf
wggstidtelkvidtnsinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltr
ngygstqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiai
npnrvfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastl
nkaksivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkf
fkvlnrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklk
nftglfef

SCOPe Domain Coordinates for d4ktxa_:

Click to download the PDB-style file with coordinates for d4ktxa_.
(The format of our PDB-style files is described here.)

Timeline for d4ktxa_:

  • d4ktxa_ appears in periodic updates to SCOPe 2.04 starting on 2014-10-16
  • d4ktxa_ appears in SCOPe 2.05
  • d4ktxa_ appears in the current release, SCOPe 2.07, called d4ktxa1