Lineage for d4ktxa1 (4ktx A:1-425)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964005Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2964006Protein Botulinum neurotoxin [55513] (4 species)
  7. 2964007Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (29 PDB entries)
    Uniprot P10845 1-419
  8. 2964042Domain d4ktxa1: 4ktx A:1-425 [260313]
    Other proteins in same PDB: d4ktxa2
    automated match to d4ej5a_
    complexed with gol, pgo, so4, zn; mutant

Details for d4ktxa1

PDB Entry: 4ktx (more details), 2.59 Å

PDB Description: crystal structure of the catalytic domain of botulinum neurotoxin bont/a c134s mutant with covalent inhibitor that modifies cys-165 causing disorder in 167-174 stretch
PDB Compounds: (A:) Botulinum neurotoxin A light chain

SCOPe Domain Sequences for d4ktxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ktxa1 d.92.1.7 (A:1-425) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
mpfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdln
pppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwgg
stidtelkvidtnsinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngy
gstqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpn
rvfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnka
ksivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkv
lnrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknft
glfef

SCOPe Domain Coordinates for d4ktxa1:

Click to download the PDB-style file with coordinates for d4ktxa1.
(The format of our PDB-style files is described here.)

Timeline for d4ktxa1: