Lineage for d4kpza2 (4kpz A:252-453)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1557864Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1557865Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1558144Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 1558145Protein automated matches [190967] (25 species)
    not a true protein
  7. 1558219Species Haemophilus influenzae [TaxId:727] [231321] (14 PDB entries)
  8. 1558229Domain d4kpza2: 4kpz A:252-453 [260312]
    Other proteins in same PDB: d4kpza1
    automated match to d2v0ha2
    complexed with 1sf, mg, pg4, so4

Details for d4kpza2

PDB Entry: 4kpz (more details), 2.09 Å

PDB Description: Hin GlmU bound to a small molecule fragment
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4kpza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kpza2 b.81.1.0 (A:252-453) automated matches {Haemophilus influenzae [TaxId: 727]}
vmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlknvvigndveikp
ysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgskvnhltyvgdse
igsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangatigagttitrdv
genelvitrvaqrhiqgwqrpi

SCOPe Domain Coordinates for d4kpza2:

Click to download the PDB-style file with coordinates for d4kpza2.
(The format of our PDB-style files is described here.)

Timeline for d4kpza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kpza1