Lineage for d4c9fc_ (4c9f C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002670Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries)
  8. 3002710Domain d4c9fc_: 4c9f C: [260299]
    Other proteins in same PDB: d4c9fd2
    automated match to d3zhgd_
    complexed with ca, gq1, so4

Details for d4c9fc_

PDB Entry: 4c9f (more details), 2.6 Å

PDB Description: structure of sign-r1 in complex with sulfodextran
PDB Compounds: (C:) cd209 antigen-like protein b

SCOPe Domain Sequences for d4c9fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c9fc_ d.169.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lcrlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskakg
ptwmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcelk
kfwickksatpc

SCOPe Domain Coordinates for d4c9fc_:

Click to download the PDB-style file with coordinates for d4c9fc_.
(The format of our PDB-style files is described here.)

Timeline for d4c9fc_: