Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries) |
Domain d4c9fc_: 4c9f C: [260299] Other proteins in same PDB: d4c9fd2 automated match to d3zhgd_ complexed with ca, gq1, so4 |
PDB Entry: 4c9f (more details), 2.6 Å
SCOPe Domain Sequences for d4c9fc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c9fc_ d.169.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lcrlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskakg ptwmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcelk kfwickksatpc
Timeline for d4c9fc_:
View in 3D Domains from other chains: (mouse over for more information) d4c9fa_, d4c9fb_, d4c9fd1, d4c9fd2 |