SCOPe 2.04: Domain d3wh9b_: 3wh9 B:

Lineage for d3wh9b_ (3wh9 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (20 species)
   not a true protein

7. Species Aspergillus niger [TaxId:5061] [260290] (1 PDB entry)

8. Domain d3wh9b_: 3wh9 B: [260292]
   automated match to d3ziza_
   complexed with cl, nag, trs

Details for d3wh9b_

PDB Entry: 3wh9, 1.57 Å

PDB Description: the ligand-free structure of manbk from aspergillus niger bk01

PDB Compounds: (B:) endo-beta-1,4-Mannanase

SCOPe Domain Sequences for d3wh9b_:

Sequence; same for both SEQRES and ATOM records:

>d3wh9b_ c.1.8.3 (B:) automated matches {Aspergillus niger [TaxId: 5061]}
sfastsglqftidgetgyfagtnsywigfltdnadvdlvmghlkssglkilrvwgfndvt
sqpssgtvwyqlhqdgkstintgadglqrldyvvssaeqhdikliinfvnywtdyggmsa
yvsayggsgetdfytsdtmqsayqtyiktvverysnssavfawelaneprcpscdtsvly
nwiektskfikgldadrmvcigdegfglnidsdgsypyqfseglnftmnldidtidfgtl
hlypdswgtsddwgngwitahgaackaagkpclleeygvtsnhcsvegawqktalsttgv
gadlfwqygddlstgkspddgntiyygtsdyqclvtdhvaaigsa

Timeline for d3wh9b_:

• d3wh9b_ is new in SCOPe 2.04-stable
  
• d3wh9b_ appears in SCOPe 2.05
  
• d3wh9b_ appears in the current release, SCOPe 2.08