SCOPe 2.08: Domain d2cgab_: 2cga B:

Lineage for d2cgab_ (2cga B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries)
   Uniprot P00766

8. Domain d2cgab_: 2cga B: [26029]

Details for d2cgab_

PDB Entry: 2cga, 1.8 Å

PDB Description: bovine chymotrypsinogen a. x-ray crystal structure analysis and refinement of a new crystal form at 1.8 angstroms resolution

PDB Compounds: (B:) chymotrypsinogen a

SCOPe Domain Sequences for d2cgab_:

Sequence; same for both SEQRES and ATOM records:

>d2cgab_ b.47.1.2 (B:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Timeline for d2cgab_:

• d2cgab_ first appeared (with stable ids) in SCOP 1.55
  
• d2cgab_ appears in SCOPe 2.07