Lineage for d4whxa_ (4whx A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (19 species)
    not a true protein
  7. 2573202Species Burkholderia pseudomallei [TaxId:557724] [260287] (1 PDB entry)
  8. 2573203Domain d4whxa_: 4whx A: [260288]
    automated match to d3u0ga_
    complexed with ala, edo

Details for d4whxa_

PDB Entry: 4whx (more details), 2.05 Å

PDB Description: x-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate
PDB Compounds: (A:) Branched-chain-amino-acid transaminase

SCOPe Domain Sequences for d4whxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4whxa_ e.17.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 557724]}
smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
aiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgy
deallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekr
itrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakha
dwltki

SCOPe Domain Coordinates for d4whxa_:

Click to download the PDB-style file with coordinates for d4whxa_.
(The format of our PDB-style files is described here.)

Timeline for d4whxa_: