SCOPe 2.04: Domain d4tvpl2: 4tvp L:116-210

Lineage for d4tvpl2 (4tvp L:116-210)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4tvpl2: 4tvp L:116-210 [260257]
   Other proteins in same PDB: d4tvpe2
   automated match to d1a3rl2
   complexed with nag, so4

Details for d4tvpl2

PDB Entry: 4tvp, 3.1 Å

PDB Description: crystal structure of the hiv-1 bg505 sosip.664 env trimer ectodomain, comprising atomic-level definition of pre-fusion gp120 and gp41, in complex with human antibodies pgt122 and 35o22

PDB Compounds: (L:) PGT122 light chain

SCOPe Domain Sequences for d4tvpl2:

Sequence; same for both SEQRES and ATOM records:

>d4tvpl2 b.1.1.0 (L:116-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaa
ssylsltpeqwkshksyscqvthegstvektvapt

Timeline for d4tvpl2:

• d4tvpl2 is new in SCOPe 2.04-stable
  
• d4tvpl2 appears in SCOPe 2.05
  
• d4tvpl2 appears in the current release, SCOPe 2.08