Lineage for d4pmya_ (4pmy A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833324Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries)
  8. 2833332Domain d4pmya_: 4pmy A: [260218]
    automated match to d3u7bb_
    complexed with ca, gol, xyp

Details for d4pmya_

PDB Entry: 4pmy (more details), 1.6 Å

PDB Description: crystal structure of gh10 endo-b-1,4-xylanase (xynb) from xanthomonas axonopodis pv citri complexed with xylose
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d4pmya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pmya_ c.1.8.0 (A:) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
aplaataskflgcaygaqqapgfaqywnkltpenggkwgsveavrdqmdwstldaayrfa
qanqmpfqmhvmvwgnqqpewiktlrpaeqrreieqwfaavaqrypdiallevvneplnd
ppskadtgggnylqalggngdsgwewvlqsfrlarrhfphtklmindysitssaqatqky
lqivrllqrenlvdaigvqehafettpevavsvhrdnldalaatglpiyitefdldgptd
aqqladykrvfpvfwehpavhgitlwgfrpglwrdkeaayliradgterpaltwlrdyva
ahp

SCOPe Domain Coordinates for d4pmya_:

Click to download the PDB-style file with coordinates for d4pmya_.
(The format of our PDB-style files is described here.)

Timeline for d4pmya_: