SCOPe 2.06: Domain d4p1ch_: 4p1c H:

Lineage for d4p1ch_ (4p1c H:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein Toluene-4-monooxygenase system protein C, TmoC [110154] (1 species)

7. Species Pseudomonas mendocina [TaxId:300] [110155] (5 PDB entries)
   Uniprot Q00458

8. Domain d4p1ch_: 4p1c H: [260215]
   Other proteins in same PDB: d4p1ca_, d4p1cc_, d4p1cd_, d4p1cf_
   automated match to d1sjga_
   complexed with fe, fes, peg

Details for d4p1ch_

PDB Entry: 4p1c, 2.4 Å

PDB Description: crystal structure of the toluene 4-monooxygenase hydroxylase- ferredoxin c7s, c84a, c85a variant electron-transfer complex

PDB Compounds: (H:) Toluene-4-monooxygenase system ferredoxin subunit

SCOPe Domain Sequences for d4p1ch_:

Sequence; same for both SEQRES and ATOM records:

>d4p1ch_ b.33.1.1 (H:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]}
sfekisslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnkahs

Timeline for d4p1ch_:

• d4p1ch_ first appeared in SCOPe 2.04
  
• d4p1ch_ appears in SCOPe 2.05
  
• d4p1ch_ appears in SCOPe 2.07
  
• d4p1ch_ appears in the current release, SCOPe 2.08