SCOPe 2.06: Domain d4onha2: 4onh A:112-200

Lineage for d4onha2 (4onh A:112-200)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d4onha2: 4onh A:112-200 [260206]
   Other proteins in same PDB: d4onha1, d4onhb1, d4onhb2
   automated match to d4eura2
   complexed with cl, gol, nag

Details for d4onha2

PDB Entry: 4onh, 3.01 Å

PDB Description: crystal structure of dn6 tcr

PDB Compounds: (A:) T-cell receptor beta

SCOPe Domain Sequences for d4onha2:

Sequence; same for both SEQRES and ATOM records:

>d4onha2 b.1.1.2 (A:112-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d4onha2:

• d4onha2 first appeared in SCOPe 2.04
  
• d4onha2 appears in SCOPe 2.05
  
• d4onha2 appears in SCOPe 2.07
  
• d4onha2 appears in the current release, SCOPe 2.08