SCOPe 2.03: Domain d3gct.1: 3gct E:,F:,G:

Lineage for d3gct.1 (3gct E:,F:,G:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (58 PDB entries)
   Uniprot P00766

8. Domain d3gct.1: 3gct E:,F:,G: [26020]
   complexed with so4

Details for d3gct.1

PDB Entry: 3gct, 1.6 Å

PDB Description: structure of gamma-*chymotrypsin in the range $p*h 2.0 to $p*h 10.5 suggests that gamma-chymotrypsin is a covalent acyl-enzyme adduct at low $p*h

PDB Compounds: (E:) gamma-chymotrypsin a, (F:) gamma-chymotrypsin a, (G:) gamma-chymotrypsin a

SCOPe Domain Sequences for d3gct.1:

Sequence; same for both SEQRES and ATOM records:

>g3gct.1 b.47.1.2 (E:,F:,G:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryXtpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

Timeline for d3gct.1:

• d3gct.1 first appeared (with stable ids) in SCOP 1.55, called d3gcta_
  
• d3gct.1 appears in SCOPe 2.02
  
• d3gct.1 appears in SCOPe 2.04
  
• d3gct.1 appears in the current release, SCOPe 2.08