SCOPe 2.04: Domain d4npfy1: 4npf Y:1-58

Lineage for d4npfy1 (4npf Y:1-58)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
   automatically mapped to Pfam PF02216

6. Protein automated matches [191290] (4 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [189943] (10 PDB entries)

8. Domain d4npfy1: 4npf Y:1-58 [260192]
   automated match to d1h0ta_

Details for d4npfy1

PDB Entry: 4npf, 1.49 Å

PDB Description: high-resolution structure of two tandem b domains of staphylococcal protein a connected by the conserved linker

PDB Compounds: (Y:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4npfy1:

Sequence; same for both SEQRES and ATOM records:

>d4npfy1 a.8.1.1 (Y:1-58) automated matches {Staphylococcus aureus [TaxId: 1280]}
adnkfnkeqqnawyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapk

Timeline for d4npfy1:

• d4npfy1 is new in SCOPe 2.04-stable
  
• d4npfy1 appears in SCOPe 2.05
  
• d4npfy1 appears in the current release, SCOPe 2.08