Lineage for d4n44a2 (4n44 A:270-392)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881785Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1881786Protein automated matches [196909] (52 species)
    not a true protein
  7. 1881902Species Clostridium acetobutylicum [TaxId:863638] [260180] (5 PDB entries)
  8. 1881912Domain d4n44a2: 4n44 A:270-392 [260185]
    automated match to d4dd5a2
    complexed with act, gol

Details for d4n44a2

PDB Entry: 4n44 (more details), 1.77 Å

PDB Description: crystal structure of oxidized form of thiolase from clostridium acetobutylicum
PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4n44a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n44a2 c.95.1.0 (A:270-392) automated matches {Clostridium acetobutylicum [TaxId: 863638]}
kplakivsygsagvdpaimgygpfyatkaaiekagwtvdeldliesneafaaqslavakd
lkfdmnkvnvnggaialghpigasgarilvtlvhamqkrdakkglatlcigggqgtaill
ekc

SCOPe Domain Coordinates for d4n44a2:

Click to download the PDB-style file with coordinates for d4n44a2.
(The format of our PDB-style files is described here.)

Timeline for d4n44a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n44a1