SCOPe 2.04: Domain d4n46b1: 4n46 B:1-269

Lineage for d4n46b1 (4n46 B:1-269)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (45 species)
   not a true protein

7. Species Clostridium acetobutylicum [TaxId:863638] [260180] (2 PDB entries)

8. Domain d4n46b1: 4n46 B:1-269 [260181]
   automated match to d4dd5a1
   complexed with act, coa

Details for d4n46b1

PDB Entry: 4n46, 1.39 Å

PDB Description: crystal structure of thiolase from clostridium acetobutylicum in complex with coa

PDB Compounds: (B:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4n46b1:

Sequence; same for both SEQRES and ATOM records:

>d4n46b1 c.95.1.0 (B:1-269) automated matches {Clostridium acetobutylicum [TaxId: 863638]}
mkevviasavrtaigsygkslkdvpavdlgataikeavkkagikpedvnevilgnvlqag
lgqnparqasfkaglpveipamtinkvcgsglrtvslaaqiikagdadviiaggmenmsr
apylannarwgyrmgnakfvdemitdglwdafndyhmgitaeniaerwnisreeqdefal
asqkkaeeaiksgqfkdeivpvvikgrkgetvvdtdehprfgstieglaklkpafkkdgt
vtagnasglndcaavlvimsaekakelgv

Timeline for d4n46b1:

• d4n46b1 is new in SCOPe 2.04-stable
  
• d4n46b1 last appears in SCOPe 2.05