SCOPe 2.02: Domain d1trya_: 1try A:

Lineage for d1trya_ (1try A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [50521] (16 PDB entries)

8. Domain d1trya_: 1try A: [26017]
   complexed with ipa, isp

Details for d1trya_

PDB Entry: 1try, 1.55 Å

PDB Description: structure of inhibited trypsin from fusarium oxysporum at 1.55 angstroms

PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1trya_:

Sequence; same for both SEQRES and ATOM records:

>d1trya_ b.47.1.2 (A:) Trypsin(ogen) {Fungus (Fusarium oxysporum) [TaxId: 5507]}
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya

Timeline for d1trya_:

• d1trya_ first appeared (with stable ids) in SCOP 1.55, called d1try__
  
• d1trya_ appears in SCOPe 2.01
  
• d1trya_ appears in SCOPe 2.03
  
• d1trya_ appears in the current release, SCOPe 2.08