SCOPe 2.08: Domain d4ck4b_: 4ck4 B:

Lineage for d4ck4b_ (4ck4 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [237679] (4 PDB entries)

8. Domain d4ck4b_: 4ck4 B: [260151]
   automated match to d4nlja_
   complexed with act, cl, na, nh4, so4

Details for d4ck4b_

PDB Entry: 4ck4, 1.12 Å

PDB Description: ovine beta-lactoglobulin at atomic resolution

PDB Compounds: (B:) beta_lactoglobulin-1/b

SCOPe Domain Sequences for d4ck4b_:

Sequence, based on SEQRES records:

>d4ck4b_ b.60.1.1 (B:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
iivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevdnealekfdkalkalpmhirlafnptqlegqchv

Sequence, based on observed residues (ATOM records):

>d4ck4b_ b.60.1.1 (B:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
iivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillqk
wegecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevdnealekfdkalkalpmhirlafnptqlegqchv

Timeline for d4ck4b_:

• d4ck4b_ first appeared in SCOPe 2.04
  
• d4ck4b_ appears in SCOPe 2.07