SCOPe 2.04: Domain d1gdqa_: 1gdq A:

Lineage for d1gdqa_ (1gdq A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [50521] (16 PDB entries)

8. Domain d1gdqa_: 1gdq A: [26015]
   complexed with gol, so4

Details for d1gdqa_

PDB Entry: 1gdq, 0.93 Å

PDB Description: fusarium oxysporum trypsin at atomic resolution

PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1gdqa_:

Sequence; same for both SEQRES and ATOM records:

>d1gdqa_ b.47.1.2 (A:) Trypsin(ogen) {Fungus (Fusarium oxysporum) [TaxId: 5507]}
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya

Timeline for d1gdqa_:

• d1gdqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1gdqa_ appears in SCOPe 2.03
  
• d1gdqa_ appears in SCOPe 2.05
  
• d1gdqa_ appears in the current release, SCOPe 2.08