![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Species Lactobacillus salivarius [TaxId:362948] [260140] (1 PDB entry) |
![]() | Domain d4c7va2: 4c7v A:337-526 [260146] Other proteins in same PDB: d4c7va3 automated match to d3hylb2 |
PDB Entry: 4c7v (more details), 2.2 Å
SCOPe Domain Sequences for d4c7va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c7va2 c.36.1.0 (A:337-526) automated matches {Lactobacillus salivarius [TaxId: 362948]} vpntlgdilpqygeddsiatraasqkainalakevsslwggaadlassnktviagegdfq pesyegrniwfgvrefgmacamngimlhggtrifgstffvfsdylkaairlsaiqklpvi yvlthdsvavgkdgpthepieqlaslrtipnvqvfrpadgnetsaawkvaletldkptil vlsrqnldtl
Timeline for d4c7va2: