Lineage for d3wx9a_ (3wx9 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867883Species Pyrococcus horikoshii [TaxId:70601] [225184] (6 PDB entries)
  8. 1867890Domain d3wx9a_: 3wx9 A: [260137]
    automated match to d1bjwa_
    complexed with 3ee, akg, g9a, glu, kya, pmp

Details for d3wx9a_

PDB Entry: 3wx9 (more details), 1.58 Å

PDB Description: crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
PDB Compounds: (A:) Putative uncharacterized protein PH0207

SCOPe Domain Sequences for d3wx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wx9a_ c.67.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
smlgdverffskkalemrasevrellklvetsdiislagglpnpktfpkeiirdilveim
ekyadkalqygttkgftplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpg
divvveaptylaalqafnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvp
tfqnpagvtmnedrrkyllelaseydfivveddpygelrysgnpekkikaldnegrviyl
gtfskilapgfrigwmvgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipe
irkfykprrdamlealeefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayv
pgeafyahrdvkntmrlnftyvdedkimegikrlaetikeelka

SCOPe Domain Coordinates for d3wx9a_:

Click to download the PDB-style file with coordinates for d3wx9a_.
(The format of our PDB-style files is described here.)

Timeline for d3wx9a_: