Lineage for d3wswb2 (3wsw B:148-315)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680841Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1680842Protein automated matches [226850] (24 species)
    not a true protein
  7. 1680930Species Enterococcus mundtii [TaxId:53346] [259612] (2 PDB entries)
  8. 1680931Domain d3wswb2: 3wsw B:148-315 [260132]
    Other proteins in same PDB: d3wswb1
    automated match to d4ln1a2
    complexed with fbp, gol, nad

Details for d3wswb2

PDB Entry: 3wsw (more details), 2.3 Å

PDB Description: Crystal structure of minor L-lactate dehydrogenase from Enterococcus mundtii in the ligands-bound form
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3wswb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wswb2 d.162.1.0 (B:148-315) automated matches {Enterococcus mundtii [TaxId: 53346]}
ttldttrfrkeialklavdprsvhgyilgehgdsevaawshttvggkpimeyvekdhrle
endltvladkvknaayeiidrkkatyygigmsttrivkailnneqavlpvsaylngeyge
ediftgvpsivdengvreiidlsitpqekamfhqsvselkavldtvrl

SCOPe Domain Coordinates for d3wswb2:

Click to download the PDB-style file with coordinates for d3wswb2.
(The format of our PDB-style files is described here.)

Timeline for d3wswb2: