Lineage for d3wswb1 (3wsw B:3-147)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580622Species Enterococcus mundtii [TaxId:53346] [259610] (2 PDB entries)
  8. 1580623Domain d3wswb1: 3wsw B:3-147 [260131]
    Other proteins in same PDB: d3wswb2
    automated match to d4ln1a1
    complexed with fbp, gol, nad

Details for d3wswb1

PDB Entry: 3wsw (more details), 2.3 Å

PDB Description: crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-bound form
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3wswb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wswb1 c.2.1.0 (B:3-147) automated matches {Enterococcus mundtii [TaxId: 53346]}
ktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgeknvs
vwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvvas
npvdiltyltwqesglpasrvvgtg

SCOPe Domain Coordinates for d3wswb1:

Click to download the PDB-style file with coordinates for d3wswb1.
(The format of our PDB-style files is described here.)

Timeline for d3wswb1: