SCOPe 2.04: Domain d4weea_: 4wee A:

Lineage for d4weea_ (4wee A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein automated matches [190234] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (5 PDB entries)

8. Domain d4weea_: 4wee A: [260125]
   automated match to d3f04a_
   complexed with na, so4

Details for d4weea_

PDB Entry: 4wee, 0.89 Å

PDB Description: high-resolution structure of synaptotagmin 1 c2a

PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d4weea_:

Sequence; same for both SEQRES and ATOM records:

>d4weea_ b.7.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gggildsmveklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkk
kkfetkvhrktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntv
dfghvteewrdlqsa

Timeline for d4weea_:

• d4weea_ is new in SCOPe 2.04-stable
  
• d4weea_ appears in SCOPe 2.05
  
• d4weea_ appears in the current release, SCOPe 2.08, called d4weea1